<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00171
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MTSDEDSPMELLDTPSSSPKSENKYKDPDDGRQRFLLELEFIQCLANPTYIHYLAQNRYFEDEAFIGYLKYLQYWQRPEYLKFIMYPHCLYFLELLQNPNYRSAMAHPANKELAHRQQFYFWKNYRNNRLKHILPKTLPEPSSVPSVPALPSTTVTAAAASAPPPIPSTAAPQAPSQMQFGTGPGSNFVKNDLRNSGIDRRKRKKDG |
| Length | 207 |
| Position | Middle |
| Organism | Erythranthe guttata (Yellow monkey flower) (Mimulus guttatus) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Lamiales> Phrymaceae> Erythranthe.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.748 |
| Instability index | 59.42 |
| Isoelectric point | 8.94 |
| Molecular weight | 23849.73 |
| Publications | PubMed=24225854
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP00171
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 83.58| 16| 19| 65| 80| 1
---------------------------------------------------------------------------
41- 59 (24.77/13.36) FIQC...LanpTYIHYLAQNRY
65- 80 (33.48/20.19) FIGY...L...KYLQYWQRPEY
83- 101 (25.34/13.81) FIMYphcL...YFLELLQNPNY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.14| 16| 16| 137| 152| 2
---------------------------------------------------------------------------
137- 152 (28.29/12.70) TLPEPSSVPSVPALPS
153- 168 (26.84/11.77) TTVTAAAASAPPPIPS
---------------------------------------------------------------------------
|