<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00161
| Description |
Uncharacterized protein (Fragment) |
| Sequence | YQDDWLKTSASSLQVWEKAPLEPYATAKHMSYYVVCPNIDPLTKAASDFFLQLGT |
| Length | 55 |
| Position | Kinase |
| Organism | Erythranthe guttata (Yellow monkey flower) (Mimulus guttatus) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Lamiales> Phrymaceae> Erythranthe.
|
| Aromaticity | 0.15 |
| Grand average of hydropathy | -0.249 |
| Instability index | 58.12 |
| Isoelectric point | 4.89 |
| Molecular weight | 6239.99 |
| Publications | PubMed=24225854
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP00161
No repeats found
No repeats found
|