<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00140
| Description |
Uncharacterized protein (Fragment) |
| Sequence | VKMTGSQPMSNFNQDGGGSEEDVVVVTLKRHLPFSGQEGLQQLKKIAVRFEERVYTEATSQSDYLRKISLKMLTMEIKPMNSTANSRQSSNAPINSKKPQEPGQKYPFQLINYSLHMHMHEVVTKLQQDISLKESKIEELKSKNASLEIRVSDLQARAENDEERYKEMTHLMSELQKTVEELHKTVKELQKNA |
| Length | 193 |
| Position | Tail |
| Organism | Erythranthe guttata (Yellow monkey flower) (Mimulus guttatus) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Lamiales> Phrymaceae> Erythranthe.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.831 |
| Instability index | 69.05 |
| Isoelectric point | 8.03 |
| Molecular weight | 22148.96 |
| Publications | PubMed=24225854
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | chromatin DNA binding GO:0031490 IBA:GO_Central
transcription coactivator activity GO:0003713 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP00140
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 90.48| 22| 25| 123| 147| 1
---------------------------------------------------------------------------
123- 144 (31.46/16.81) VTKLQQDISLKESKIEELKSKN
151- 170 (26.95/17.20) VSDLQARAENDEERYKEMTH..
172- 192 (32.07/17.36) MSELQKTVEELHKTVKELQ.KN
---------------------------------------------------------------------------
|