<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00128
| Description |
Uncharacterized protein |
| Sequence | MDSGSIQFGKGPRELTGALDLISHYKLLPHHEFFCKKSSPVSVLDTHYLYNVVGDTDIRKGEGMQLDQLIQNAHSRDTLSRIQPFNLNVLGEAFRLQESSSVDLPPSEKGIPTVAVKTKSESKTKDKQRKHKDKDKDTKKHKHRSKEEKEKRKAEKKKRRDRDGGEEEANAVKKHKKK |
| Length | 178 |
| Position | Head |
| Organism | Erythranthe guttata (Yellow monkey flower) (Mimulus guttatus) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Lamiales> Phrymaceae> Erythranthe.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.244 |
| Instability index | 45.64 |
| Isoelectric point | 9.71 |
| Molecular weight | 20367.88 |
| Publications | PubMed=24225854
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP00128
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 71.01| 15| 15| 130| 144| 1
---------------------------------------------------------------------------
130- 144 (25.92/11.75) KHKDKDKDTKKHKHR
147- 160 (22.70/ 9.51) EEKEKRKAEKK.KRR
164- 178 (22.39/ 9.30) GGEEEANAVKKHKKK
---------------------------------------------------------------------------
|