<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00117

Description Uncharacterized protein
SequenceMAAMEGVTMAGAQDQPPKVVERLNPAVQQQLNLDSVKTRAISLFKAISRILEEFDVIARTNAVPKWQYVLGQFSMVNLELYNIVEDIKNVSKAFVVHPKNVNAENATILPVMLSSKLLPEIEVEDNVKREQLLHGMQILPVAAQIEKLKTRIDMIGAACESAEKIIADARKAYFGTRQGPTLLPTVDKVQAAKIQEQENLLRSAVNHGEGLRMPGDQRQVTSSLPMHLVDVLATNDTTQTFPDSSGMYQKGTPPLLTTAGNNSQGSLLQVSGAQFGRAAASPSGATGSTSFDNTTASPLQYANSPRSGANIMNMPSPQQQQPQQLQQHQQQQRQKMMQQQLLNQQQLRGSSMPSLGQSQLPQLHDMTSQAQQKFQSMQGQHHVQFSQPLSAQQLQGRQLASSAMHMGQNQLNQGNQLNRQLNQFSSPANSAIFNAAQTTPASQMIPNMSAMMPSQSILPRMQFGISGGNRTLPAPSLSDQMYNMGAANAGGMMPIQQQQQQQQQQQQGAFGNMSQNTPQNIQSNMLPMQNTSQNHPNFQQQRQQNQQ
Length547
PositionHead
OrganismErythranthe guttata (Yellow monkey flower) (Mimulus guttatus)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Lamiales> Phrymaceae> Erythranthe.
Aromaticity0.04
Grand average of hydropathy-0.585
Instability index62.96
Isoelectric point9.34
Molecular weight60081.23
Publications
PubMed=24225854

Function

Annotated function 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP00117
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             6|     270.71|      39|      40|     467|     505|       1
---------------------------------------------------------------------------
  233-  280 (37.88/10.14)	A......TNDTTQTF.PDSSGMYQKGTPpllttagnnSQGSLL..QVSGAQFGRAAA
  284-  324 (36.32/ 9.41)	G....atGSTSFDNT.TASPLQYANSPR.........SGANIMnmPSPQQQQPQQ..
  389-  427 (41.16/11.67)	L......SAQQLQGR.QLASSAMHMGQN.......qlNQGN....QLNRQLNQFSSP
  428-  464 (37.26/ 9.85)	AnsaifnAAQTTPAS.QM...IPNMSA..............MM..PSQSILPRMQFG
  467-  505 (69.85/25.08)	G......GNRTLPAP.SLSDQMYNMGAA.........NAGGMM..PIQQQQQQQQQQ
  508-  547 (48.24/14.98)	G....afGNMSQNTPqNIQSNMLPM..Q.........NTSQNH..PNFQQQRQQNQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      84.53|      26|      36|     325|     353|       2
---------------------------------------------------------------------------
  325-  353 (36.76/18.38)	LQQHQQQQRQKMmqQQLLNQQQLRgSSMP
  363-  388 (47.77/16.25)	LHDMTSQAQQKF..QSMQGQHHVQ.FSQP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      35.23|      11|      40|     177|     187|       4
---------------------------------------------------------------------------
  177-  187 (20.38/10.99)	RQGPTL.LPTVD
  206-  217 (14.85/ 6.08)	NHGEGLrMPGDQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     108.69|      34|      40|      75|     108|       5
---------------------------------------------------------------------------
   75-  108 (54.33/51.68)	MVNLELYNIVEDIKNVSKAFVVHPKNVNAENATI
  112-  145 (54.36/51.71)	MLSSKLLPEIEVEDNVKREQLLHGMQILPVAAQI
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP00117 with Med8 domain of Kingdom Viridiplantae
Unable to open file!