<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00107
| Description |
Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MTSLNQDQIKALEQSRQRLVQLTHSLSSLITSLNTSDPLPSWSSLQSQATIISNNLVTVSEHLTDQQDLFGSLVAYPGPDYPSRTQGPALEQLLRTKLDPRVEDWVSRGRTAGQKSQSQARALIRGQELSAGDLTELWEWAPVEANQEARGRNWGGNFTLEEKEAGIENVVTGLRRELEDEDESEEEEEEEEDQMDIVGARRKTSGGGLEFDIAARQPAEVAAAGPVMPLDDVLRFMTTGLPPKQR |
| Length | 246 |
| Position | Head |
| Organism | Aspergillus ruber CBS 135680 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.672 |
| Instability index | 61.17 |
| Isoelectric point | 4.53 |
| Molecular weight | 27251.77 |
| Publications | PubMed=24811710
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP00107
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.97| 16| 24| 161| 177| 1
---------------------------------------------------------------------------
161- 177 (22.22/20.86) EEKEAGIENVVtGLRRE
188- 203 (27.75/20.30) EEEEEDQMDIV.GARRK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.19| 21| 145| 74| 101| 2
---------------------------------------------------------------------------
74- 101 (34.54/33.77) VAYPGPDYPsrtqgpaLEQLLR...TKLDPR
221- 244 (34.65/19.12) VAAAGPVMP.......LDDVLRfmtTGLPPK
---------------------------------------------------------------------------
|