<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00106
| Description |
Uncharacterized protein |
| Sequence | MADILTQLQTCLDQLATQFYATLGYLTTYHDNSPAIQPQVPDAAPALAKITKNSTAHPVPANVASQSQGQASPPPPGQTGGGSAAPETPGGKGDGGAGGVGGGGLNDPLAPAPDLPSTFASRQRELARDLIIKEQQIEYLISVLPGIGSSEKEQEIRLKELEGELRTVEEERERKVRELRGLRRKLEGVLGGVEMGIYGER |
| Length | 201 |
| Position | Middle |
| Organism | Aspergillus ruber CBS 135680 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.489 |
| Instability index | 60.65 |
| Isoelectric point | 5.07 |
| Molecular weight | 21218.55 |
| Publications | PubMed=24811710
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP00106
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.78| 18| 18| 146| 163| 1
---------------------------------------------------------------------------
133- 151 (22.42/13.66) KEQQIEyLISVLPGIGSSE
152- 169 (28.36/19.16) KEQEIR.LKELEGELRTVE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.93| 19| 19| 64| 82| 2
---------------------------------------------------------------------------
64- 82 (36.82/14.69) ASQSQGQASPPPPGQTGGG
85- 103 (36.11/14.29) APETPGGKGDGGAGGVGGG
---------------------------------------------------------------------------
|