<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00101

Description Mediator of RNA polymerase II transcription subunit 12
SequenceMIPLSSAGAQPRGHHPLRAVNTASGQPNTFQTLAQSDANLPTPVAQAQFRQHPTVIDLTSGEDAQEREPPAKRPRLDIPTGTSSGTASPVPGVGGIGGGDLRTAPGGPTTPRPPSTTSWRGRPVWSFQSLVSETPGVGDVYGDNAAALAQSGKPASPPPLPTPPWRFAPQRPSSSRSRDSSPVKAVQTTPYRIETPPVAPALKGEKVADFSPWTGHHPEDILNEQTAKQGYYDRTQVSQNESNTARPSLYAQLKHRSGLQMLSSVFASAFEKRQGHNTVATSSTFKPPPRVTLTDNKRESWLRDLANPAVPLRRLSRTIPHGIRGKVLLDQCLGKWVPVARAVWLAKCVGANEIRAFKRKGTSGPLAVGLEAKWVRDWTVNVQQFLETIIAACGTADWKMKMTYAVSLTARLFHENLLDHDHYTGWFLSCLEAAPLKTLPVWLLMLGIYWGSIMRYRKRGRRLAELLLAKLTHISKSEHAGALKPLIDRLSLYVKRLIREHTSSAILPTSWATYRDLVSSSLNLDDKVDRAIFQNIAERNVRVQRPMPCQSAAHRSGQQQQQYIIRLFDSIRTAHDISSVSVACLDTFEDRATLIHKLLEWTATPFRHGLRRVYIAVRLLRKWKMAGIDVDSHILGFLSDSPKANENMDMVYHAISELVRSQTFSVGRYLQWLMAKGVSRDSLSDHNVSYPLSLPRSHPLTERQIIPGGIGLLSQLPVSHLPEHVRNLRDTLLVRVGIASSEEATVISQVKNSIATRLPRVFGGYEADCTFEPAYQSLTWAVKSEIGQWVRRAVAQHCRDPTRSVSGVPFLTDLKVSSLTPDEFYEIRGLLESFGDISMLADVVKQAASSDDNTVLASAADTVNYHCGSFNVIGAATDLFRRLVDAYSLLKRLGTADLDLIYSLIELGLQLPNEYNTVAILRQDLSRIENRSAQAAPSPLSDHIPDTVTETDPSFLEKLDRFLSSGGGMDEQTMDAIFDALTKVLDKGDGQTKLSANDACRYLAHLRPFHPKHFDTRLVRWVCGALKMSDRTEFFKSLSPLIGVGCVTIQAFLSLVKKLLQVKPTSVPNVDELQMDLFELLAPPARQDGCRDLVTYRFYLAQHEFRTKHLEETLEVIRGAVASIGQNEGLSSDPTRNHLETSMAILLCDLLTNEPGNAAQQSMLKLTDQQPAFLVALQNALDRLLGLDSSGQAENNLSEAERVISMTSDFSLPFCQLKLQMLFNAASGEEVKNGVVDVMFKMAVGDSRSKRSNWVGLVALMNQDAVRQIRERAEKEFLSVPMLPLEASADEDGLSSVNYTNAVETAKIYLMIIEELAYSVPESGVPSIAPILVEKMDLLLNKFVIMQTNFTNFAENKNDTNGEGQLNKARSDFERGLAFWFSVLLRMVVIHRSAFTSSTRPTSLQEQTRILISIFSVALARFPNSLLRLFPTADYFPHPHQPGDYRPCPGILLQTHALDVAASLIDTFPDEARHHCARFLKEKCPPFAQFQNDSRFLYLLGPLPGYGAGANTAQPVSLPSPAASGSTPTPSQAQPPAAAAAPSPSLSAGLPSAEGPNCISNSLRLQYRGRIVGTYHIRPWELLEDAAPLAGVNDTAISLRYFDARRIRA
Length1609
PositionKinase
OrganismAspergillus ruber CBS 135680
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus.
Aromaticity0.07
Grand average of hydropathy-0.232
Instability index47.00
Isoelectric point8.66
Molecular weight177517.28
Publications
PubMed=24811710

Function

Annotated function Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. Component of the srb8-11 complex. The srb8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The srb8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP00101
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      72.63|      16|      19|      46|      61|       1
---------------------------------------------------------------------------
   46-   61 (27.58/15.20)	QAQFRQHPT...VIDLTSG
   63-   81 (21.37/ 9.88)	DAQEREPPAkrpRLDIPTG
   84-   99 (23.69/11.87)	SGTASPVPG...VGGIGGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.07|      16|      19|     317|     334|       3
---------------------------------------------------------------------------
  317-  334 (23.85/19.48)	RTIPhgIRGKVLLDQCLG
  335-  350 (30.23/16.98)	KWVP..VARAVWLAKCVG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      60.91|      19|      19|     950|     968|       5
---------------------------------------------------------------------------
  950-  968 (33.16/25.17)	E.TDPSFLEKLDRFLSSGGG
  971-  990 (27.75/19.60)	EqTMDAIFDALTKVLDKGDG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.45|      13|     122|      24|      43|       7
---------------------------------------------------------------------------
   24-   43 (20.10/22.23)	SGQPntfqtlaQSDANLPTP
  151-  163 (28.35/13.76)	SGKP.......ASPPPLPTP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     135.13|      41|     163|    1101|    1141|       9
---------------------------------------------------------------------------
 1101- 1141 (68.56/53.31)	AQHEFRTKHLEETLEVIRGAVASIGQNEGLSSDPTRNHLET
 1265- 1305 (66.57/51.51)	AVRQIRERAEKEFLSVPMLPLEASADEDGLSSVNYTNAVET
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      70.97|      20|     163|       3|      22|      10
---------------------------------------------------------------------------
    3-   22 (36.30/17.79)	PLSSAGAQPRGHHPLRAVNT
  169-  188 (34.66/16.66)	PQRPSSSRSRDSSPVKAVQT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      52.67|      15|     163|     197|     214|      11
---------------------------------------------------------------------------
  197-  214 (23.11/23.31)	PVAPALKGEKVADfspWT
  365-  379 (29.56/18.41)	PLAVGLEAKWVRD...WT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     100.57|      36|     163|     884|     927|      12
---------------------------------------------------------------------------
  614-  658 (48.86/22.84)	YIAVRLLRKWKMAGID.VDSHI.LGFlsDSPkaNEnmdmvYHAISEL
  884-  921 (51.71/45.49)	VDAYSLLKRLGTADLDlIYSLIeLGL..QLP..NE.....YNTVAIL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      41.16|      14|     163|    1193|    1210|      13
---------------------------------------------------------------------------
 1177- 1191 (18.39/12.06)	LQNAlDRLLGLDSSG
 1197- 1210 (22.77/ 8.43)	LSEA.ERVISMTSDF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     204.96|     101|     260|     461|     578|      15
---------------------------------------------------------------------------
  462-  510 (30.70/42.59)	........................................................................................................................................................................................................................................................RLAELLLAKLTHISKSEHAGALKPLID........RLSLyVKRLIRehtssaILPTS
  514-  578 (70.46/67.71)	YRDL...VSSslNLDDKVDRAIFQNIAERNvRVQRPMPCQSAAHRSGQQQQQ.YIIR.LFDSIrtaHDIS...........................................................................................................................................................................................................................................
  775-  838 (64.53/41.74)	YQSLtwaVKS..EIGQWVRRAVAQHCRDPT.RSVSGVPFLTDLKVSSLTPDEfYEIRgLLESF...GDIS...........................................................................................................................................................................................................................................
 1017- 1066 (39.27/16.82)	......................................................................mladvvkqaassddntvlasaadtvnyhcgsfnvigaatdlfrrlvdaysllkrlgtadldliyslielglqlpneyntvailrqdlsrienrsaqaapsplsdhipdtvtetdpsflekldrflssgggmdeqtmdaifdaltkvldkgdgqtklsandacrylahlrpfhpkhfdtRLVRWVCGALKMSDRTEFFKSLSPLIGvgcvtiqaFLSL.VKKLLQ......VKPTS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      47.62|      13|     604|     933|     945|      20
---------------------------------------------------------------------------
  933-  945 (26.80/16.76)	AQAAPSP.LSDHIP
 1538- 1551 (20.82/10.96)	AAAAPSPsLSAGLP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.92|      15|      15|    1466|    1480|      21
---------------------------------------------------------------------------
 1466- 1480 (29.38/18.35)	DTFPDEAR.HHCARFL
 1482- 1497 (24.54/14.02)	EKCPPFAQfQNDSRFL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP00101 with Med12 domain of Kingdom Fungi
Unable to open file!