<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00098
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSDRASSATFRVGFPSPSSPSVGYLKEIDQPYISSDHFPQTPTSPPLMSVSAQSHAIHFASSQTSPRQATSQSADYSSLPSSDPMSSQISQQPTLSSTTTSFPTPASSVSGHLVDADKSTGTGMQEPGSTAMADADAALTQTPPQHTRTDHDRDMGGTDPGTGVRNSANIDAMEIDNNDNGGSSNNGGAASSEKNGFNLDSLQREFTSAYHLCKSSHVVTGPDPSLDLVSLYGLGPAAKSVARIDPVTGDKINRLRKSYEGKLKGLGLAGRNKPVKNEPGMPGSLRHLTMWPEEEWQNQKVFGKQIKVADMDSTLQQLQVKAMKLEPGTVPNNDYWEDVLGHEKPSKYTGAGDAGKKTVAPSGGVRAPSQPNGIPASAELERSRPSRGHKRRYDDNSFIGYGEGYADDDDEGAFYSNSEGIGKKKRKKV |
| Length | 429 |
| Position | Head |
| Organism | Aspergillus ruber CBS 135680 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.801 |
| Instability index | 49.74 |
| Isoelectric point | 6.14 |
| Molecular weight | 45720.68 |
| Publications | PubMed=24811710
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP00098
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.16| 18| 21| 97| 117| 1
---------------------------------------------------------------------------
97- 117 (26.59/22.16) STTTSFPTPASSVsghLVDAD
119- 136 (33.57/18.63) STGTGMQEPGSTA...MADAD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.85| 19| 21| 25| 45| 2
---------------------------------------------------------------------------
25- 45 (33.21/21.86) LKEID.QPYisSDHFPQTPTSP
47- 66 (29.63/13.88) LMSVSaQSH..AIHFASSQTSP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.45| 19| 22| 191| 212| 4
---------------------------------------------------------------------------
191- 212 (25.28/23.80) SSE.KNGFNlDSLqrEFTSAYHL
215- 234 (30.17/16.56) SSHvVTGPD.PSL..DLVSLYGL
---------------------------------------------------------------------------
|