| Description | Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MEERMSSSMIGVKCDRREAQLPSVHKERRKTDQGPYPTNFIQSDKDALADMLQNDALSSRRCSTYRSIRMDYKIQLSTAQLEPPEEQRRRFEIECEFVQALANPHYVNFLAQRGFLKEQHFINYLKYLLYWKQPEYARVRVDNSAEQLRMKVAEHVCT |
| Length | 158 |
| Position | Middle |
| Organism | Ancylostoma ceylanicum |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Strongylida> Ancylostomatoidea> Ancylostomatidae> Ancylostomatinae> Ancylostoma. |
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.809 |
| Instability index | 67.49 |
| Isoelectric point | 8.67 |
| Molecular weight | 18783.17 |
| Publications | PubMed=25730766 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP00085
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 99.04| 30| 58| 1| 30| 2
---------------------------------------------------------------------------
1- 30 (51.92/31.70) MEERMSSSMIGVKCDRR....EAQLPSVHKERRK
57- 90 (47.12/28.23) LSSRRCSTYRSIRMDYKiqlsTAQLEPPEEQRRR
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) YPTNFIQ 2) YRSIRMDY | 36 65 | 42 72 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab