Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MEERMSSSMIGVKCDRREAQLPSVHKERRKTDQGPYPTNFIQSDKDALADMLQNDALSSRRCSTYRSIRMDYKIQLSTAQLEPPEEQRRRFEIECEFVQALANPHYVNFLAQRGFLKEQHFINYLKYLLYWKQPEYARVRVDNSAEQLRMKVAEHVCT |
Length | 158 |
Position | Middle |
Organism | Ancylostoma ceylanicum |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Strongylida> Ancylostomatoidea> Ancylostomatidae> Ancylostomatinae> Ancylostoma. |
Aromaticity | 0.09 |
Grand average of hydropathy | -0.809 |
Instability index | 67.49 |
Isoelectric point | 8.67 |
Molecular weight | 18783.17 |
Publications | PubMed=25730766 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
Binary Interactions |
Repeats | >MDP00085 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 99.04| 30| 58| 1| 30| 2 --------------------------------------------------------------------------- 1- 30 (51.92/31.70) MEERMSSSMIGVKCDRR....EAQLPSVHKERRK 57- 90 (47.12/28.23) LSSRRCSTYRSIRMDYKiqlsTAQLEPPEEQRRR --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) YPTNFIQ 2) YRSIRMDY | 36 65 | 42 72 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab