<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00084
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MEERMSSSMIGVKCDRREAQLPSVHKERRKTDQGPYPTNFIQSDKDALADMLQNDALSSRRCSTYRSIRMDYKIQLSTAQLEPPEEQRRRFEIECEFVQALANPHYVNFLAQRGFLKEQHFINYLKYLLYWKQPEYARFCRFLEKFIFLH |
| Length | 150 |
| Position | Middle |
| Organism | Ancylostoma ceylanicum |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Strongylida>
Ancylostomatoidea> Ancylostomatidae> Ancylostomatinae> Ancylostoma.
|
| Aromaticity | 0.13 |
| Grand average of hydropathy | -0.738 |
| Instability index | 67.89 |
| Isoelectric point | 8.90 |
| Molecular weight | 18097.51 |
| Publications | PubMed=25730766
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP00084
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 99.04| 30| 58| 1| 30| 2
---------------------------------------------------------------------------
1- 30 (51.92/30.56) MEERMSSSMIGVKCDRR....EAQLPSVHKERRK
57- 90 (47.12/27.23) LSSRRCSTYRSIRMDYKiqlsTAQLEPPEEQRRR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.88| 12| 31| 105| 116| 3
---------------------------------------------------------------------------
105- 116 (22.23/11.53) HYVNFLAQRGFL
138- 149 (22.65/11.84) RFCRFLEKFIFL
---------------------------------------------------------------------------
|