<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00080
| Description |
Uncharacterized protein |
| Sequence | MESLQSNLPHPQIISDTGESRFNQLERTLEQFQENARHLGVIATDFGARSQEPFNQKIHTLVSGLQVCLLR |
| Length | 71 |
| Position | Middle |
| Organism | Ancylostoma ceylanicum |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Strongylida>
Ancylostomatoidea> Ancylostomatidae> Ancylostomatinae> Ancylostoma.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.482 |
| Instability index | 57.59 |
| Isoelectric point | 5.82 |
| Molecular weight | 8075.98 |
| Publications | PubMed=25730766
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP00080
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.09| 18| 26| 1| 18| 1
---------------------------------------------------------------------------
1- 18 (33.29/19.23) MESLQSNLPHPQIIS.DTG
29- 47 (27.80/15.27) LEQFQENARHLGVIAtDFG
---------------------------------------------------------------------------
|