<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00079
Description |
Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MSLLCRIGEKSEDFELDQMRNQFADVKVPLELLDVLDQGKNPQLYTKEVLERTLQKNKEVNGKVETYKKFHAALLKELGEEMPEDTMTYRNIRDILDK |
Length | 98 |
Position | Middle |
Organism | Ancylostoma ceylanicum |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Strongylida>
Ancylostomatoidea> Ancylostomatidae> Ancylostomatinae> Ancylostoma.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.747 |
Instability index | 31.28 |
Isoelectric point | 5.06 |
Molecular weight | 11517.10 |
Publications | PubMed=25730766
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP00079
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.89| 15| 19| 54| 71| 1
---------------------------------------------------------------------------
54- 68 (24.86/20.51) LQK..NKEVNGKVETYK
74- 90 (22.03/ 8.46) LLKelGEEMPEDTMTYR
---------------------------------------------------------------------------
|