Description | Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MLRKMSLLCRIGEKSEDFELDQMRNQFADVKVPLELLDVLDQGKNPQLYTKEVLERTLQKNKEVNGKVETYKKFHAALLKELGEEMPEDTMTYRNIRDILDK |
Length | 102 |
Position | Middle |
Organism | Ancylostoma ceylanicum |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Strongylida> Ancylostomatoidea> Ancylostomatidae> Ancylostomatinae> Ancylostoma. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.744 |
Instability index | 35.53 |
Isoelectric point | 5.50 |
Molecular weight | 12045.81 |
Publications | PubMed=25730766 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP00078 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 46.89| 15| 19| 58| 75| 1 --------------------------------------------------------------------------- 58- 72 (24.86/22.37) LQK..NKEVNGKVETYK 78- 94 (22.03/ 9.22) LLKelGEEMPEDTMTYR --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) KSEDFELDQMRNQFADVKVPLELLDVLDQGKNPQLYTKEVLERTLQKNKEVNGKVETYKKFHAALLKELGEEMPEDTMTYRNIRDILDK 2) MLRKMSLLCRI | 14 1 | 102 11 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab