<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00077
| Description |
Uncharacterized protein |
| Sequence | MPSCEDEVLSIGRKLDKIIDGSKSGENAADLLEVLSKLPITIDILTKTRIGMTINDLRKKTSDEKLAKKAKGLIKEWKNLVDKREDKKEKIVWHYFSSSHPKSQKKLA |
| Length | 108 |
| Position | Unknown |
| Organism | Ancylostoma ceylanicum |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Strongylida>
Ancylostomatoidea> Ancylostomatidae> Ancylostomatinae> Ancylostoma.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.665 |
| Instability index | 28.09 |
| Isoelectric point | 9.52 |
| Molecular weight | 12262.20 |
| Publications | PubMed=25730766
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP00077
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.78| 18| 20| 51| 69| 2
---------------------------------------------------------------------------
45- 65 (21.60/17.80) LTKTriGMtIND...LRKKTSDEK
66- 88 (19.18/10.38) LAKKakGL.IKEwknLVDKREDKK
---------------------------------------------------------------------------
|