<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00075
| Description |
Uncharacterized protein |
| Sequence | MPSCEDEVLSIGRKLDKIIDGSKSGENAADLLEVLSKLPITIDILTKTRIGMTINDLRKKTSDEKLAKKAKGLIKEWKNLVDKREDKKEKVHKGTGDKYKAALRSRVFNLRDKKNPALRENVLTGVVKPEKFAVMTSEEMASDEVREMRDKFNKAAILEHQMSVQQVSSSAICESVGEKKEAVLMVQRTPSHYADNMRKKSFKGTPSDMFKCGKCGKKNCTYTQLQTRSSDEPMTTFVFCLECGNRWKFC |
| Length | 250 |
| Position | Unknown |
| Organism | Ancylostoma ceylanicum |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Strongylida>
Ancylostomatoidea> Ancylostomatidae> Ancylostomatinae> Ancylostoma.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.669 |
| Instability index | 36.15 |
| Isoelectric point | 9.37 |
| Molecular weight | 28308.56 |
| Publications | PubMed=25730766
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | nucleic acid binding GO:0003676 IEA:InterPro
zinc ion binding GO:0008270 IEA:InterPro
|
| GO - Biological Process | transcription, DNA-templated GO:0006351 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP00075
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.74| 22| 25| 7| 31| 1
---------------------------------------------------------------------------
7- 31 (31.18/31.88) EVLSigrKLD...KIIDGSKSGENAADL
33- 57 (32.55/23.08) EVLS...KLPitiDILTKTRIGMTINDL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.92| 16| 28| 79| 94| 3
---------------------------------------------------------------------------
79- 94 (28.13/14.99) NLVDKREDK.KEKVHKG
109- 125 (21.78/10.26) NLRDKKNPAlRENVLTG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.93| 23| 26| 135| 158| 4
---------------------------------------------------------------------------
135- 158 (32.65/27.05) MTSEEMASDEVREMRDKfNKAAIL
162- 184 (36.28/24.40) MSVQQVSSSAICESVGE.KKEAVL
---------------------------------------------------------------------------
|