<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00062
| Description |
Uncharacterized protein |
| Sequence | MGVSWVFEHEKTAKEVERLLEGGGAEQIGTFTVDCLPYIPNDKLQSCIQHNYVLHHSNFPQSSFSIGRFSMCMFSCSCILFFAFSFTANPSGQMLMQQMTFDESKRY |
| Length | 107 |
| Position | Head |
| Organism | Ancylostoma ceylanicum |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Strongylida>
Ancylostomatoidea> Ancylostomatidae> Ancylostomatinae> Ancylostoma.
|
| Aromaticity | 0.14 |
| Grand average of hydropathy | -0.098 |
| Instability index | 52.68 |
| Isoelectric point | 5.71 |
| Molecular weight | 12223.85 |
| Publications | PubMed=25730766
|
Function
| Annotated function |
|
| GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP00062
No repeats found
No repeats found
|