<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00058
| Description |
Uncharacterized protein |
| Sequence | MNSSENKEEQCQSNLNKIYSDLLHLICSFEKGSGSELTVRLRQVESGLEQLREAIRSIPDIQNNEQRQRDKIASLYR |
| Length | 77 |
| Position | Middle |
| Organism | Ancylostoma ceylanicum |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Strongylida>
Ancylostomatoidea> Ancylostomatidae> Ancylostomatinae> Ancylostoma.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.896 |
| Instability index | 48.28 |
| Isoelectric point | 5.79 |
| Molecular weight | 8938.88 |
| Publications | PubMed=25730766
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP00058
No repeats found
No repeats found
|