<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00057
Description |
Uncharacterized protein |
Sequence | MGYQQASPSPRGRGAAQWTGRGGGPGGVSPFQKRTSHMGENSPRMVSPTVNINFVSPPPRMNPPPVSKVEQMSSDSSSSSSSDDESPK |
Length | 88 |
Position | Middle |
Organism | Ancylostoma ceylanicum |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Strongylida>
Ancylostomatoidea> Ancylostomatidae> Ancylostomatinae> Ancylostoma.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.997 |
Instability index | 88.21 |
Isoelectric point | 9.98 |
Molecular weight | 9231.05 |
Publications | PubMed=25730766
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP00057
No repeats found
No repeats found
|