<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00018
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MDKIIDARFERVEKALAVLIESVSKYHPHAKQALDLREADHDLTKGLDEGKLTSDTSSLGDQANPTIAVQIHQNNNLRLQQLRATTASLDTQIRETLSSLATTRKDITTTQITVHPDGPNYPVKYDELLNYARRISKTTLPPAALTNGGLTTGGGSPGPDLNASMTTNPNTPGANGLQSQPVSAAPTPSQSQTPGPSGAANGSPVGGSQDLLQGTQQTTATSLPDGLRNHLNPHFNATFVPWPSEGMIRSGAMAMYQNLADSGTDPRGYDPQQIAEAKRKEEEERKVREEQEKAEIERKNREYAEKMEKIRREQQEAYRRDSVAAGAGGGASSAGKSKQFQFTSLMDDDDDDE |
| Length | 353 |
| Position | Middle |
| Organism | Colletotrichum fioriniae PJ7 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Glomerellales> Glomerellaceae> Colletotrichum>
Colletotrichum acutatum species complex.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.859 |
| Instability index | 50.41 |
| Isoelectric point | 5.33 |
| Molecular weight | 38235.62 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP00018
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 169.94| 41| 45| 116| 157| 1
---------------------------------------------------------------------------
99- 141 (59.62/35.91) SLATTRKDITTTQITVhPD.......GPNYPvKYDELLNYARRISKTTLP
142- 188 (57.36/30.52) PAALTNGGLTTGGGSPgPDlnasmttNPNTP.GANGL..QSQPVSAAPTP
189- 224 (52.95/27.61) SQSQTPGPSGAANGSP.........vGGS.....QDLLQGTQQTTATSLP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.52| 17| 20| 275| 294| 2
---------------------------------------------------------------------------
278- 294 (28.64/28.36) KRKEEE..ER..KVREEQEKA
297- 317 (19.88/ 8.35) ERKNREyaEKmeKIRREQQEA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.64| 17| 28| 51| 67| 4
---------------------------------------------------------------------------
51- 67 (28.48/15.39) KLTSDTSSLGDQANPTI
81- 97 (27.16/14.39) QLRATTASLDTQIRETL
---------------------------------------------------------------------------
|