Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MDKIIDARFERVEKALAVLIESVSKYHPHAKQALDLREADHDLTKGLDEGKLTSDTSSLGDQANPTIAVQIHQNNNLRLQQLRATTASLDTQIRETLSSLATTRKDITTTQITVHPDGPNYPVKYDELLNYARRISKTTLPPAALTNGGLTTGGGSPGPDLNASMTTNPNTPGANGLQSQPVSAAPTPSQSQTPGPSGAANGSPVGGSQDLLQGTQQTTATSLPDGLRNHLNPHFNATFVPWPSEGMIRSGAMAMYQNLADSGTDPRGYDPQQIAEAKRKEEEERKVREEQEKAEIERKNREYAEKMEKIRREQQEAYRRDSVAAGAGGGASSAGKSKQFQFTSLMDDDDDDE |
Length | 353 |
Position | Middle |
Organism | Colletotrichum fioriniae PJ7 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Glomerellales> Glomerellaceae> Colletotrichum> Colletotrichum acutatum species complex. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.859 |
Instability index | 50.41 |
Isoelectric point | 5.33 |
Molecular weight | 38235.62 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP00018 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 169.94| 41| 45| 116| 157| 1 --------------------------------------------------------------------------- 99- 141 (59.62/35.91) SLATTRKDITTTQITVhPD.......GPNYPvKYDELLNYARRISKTTLP 142- 188 (57.36/30.52) PAALTNGGLTTGGGSPgPDlnasmttNPNTP.GANGL..QSQPVSAAPTP 189- 224 (52.95/27.61) SQSQTPGPSGAANGSP.........vGGS.....QDLLQGTQQTTATSLP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 48.52| 17| 20| 275| 294| 2 --------------------------------------------------------------------------- 278- 294 (28.64/28.36) KRKEEE..ER..KVREEQEKA 297- 317 (19.88/ 8.35) ERKNREyaEKmeKIRREQQEA --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 55.64| 17| 28| 51| 67| 4 --------------------------------------------------------------------------- 51- 67 (28.48/15.39) KLTSDTSSLGDQANPTI 81- 97 (27.16/14.39) QLRATTASLDTQIRETL --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EQQEAYRRDSVAAGA 2) SAGKSKQFQFTSLMDDDDDDE | 313 333 | 327 353 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab