<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP00013

Description Uncharacterized protein
SequenceMWRGIGYGGLHSHSSYPADRGLGHINYQPKVRVIERYKVVGFISSGTYGRVYKALGRQGQTGEFAIKKFKPDKEGEQISYTGISQSAIREMSLCSELKHANVIKLIEIILEDKCIFMVFEYAEHDLLQIIHHHTQNPRHPIPPQTVKSIMFQLLNGCQYLHANWVLHRDLKPANIMVTSAGEVKIGDLGLARRFDKPLHSLFSGDKVVVTIWYRAPELILGSRHYTPAIDMWAVGCIFAELLSLRPIFKGEEAKMDSKKTVPFQRNQMQKIVDIMGLPSKERWPLLSAMPEYPQLATLQPPMTPHHHGHHGHHRGHGYGHHPPAPSGSNLEKWYYSTISQGASSSATSAPQGGNGGGAPLASLGAEGYKLLASLLEYDPVERLTAAKALQHPFFSTGDRLNAHCFEGLKNEYPHRRVSQDDNDIRTSSLPGTKRSGLPDDSLSRPTKKLREI
Length452
PositionKinase
OrganismColletotrichum fioriniae PJ7
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Glomerellales> Glomerellaceae> Colletotrichum> Colletotrichum acutatum species complex.
Aromaticity0.08
Grand average of hydropathy-0.438
Instability index37.35
Isoelectric point9.24
Molecular weight50521.20
Publications

Function

Annotated function
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:InterPro
protein kinase activity	GO:0004672	IEA:InterPro
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP00013
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      75.54|      20|     173|     104|     139|       1
---------------------------------------------------------------------------
  120-  139 (39.02/40.53)	EYAEHDLLQ...IIHHHTQNPRH
  291-  313 (36.52/11.44)	EYPQLATLQppmTPHHHGHHGHH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     181.36|      52|      76|     319|     370|       2
---------------------------------------------------------------------------
  319-  370 (93.75/63.67)	GHHPPAPSGSNLEKWY.YSTISQGASSSATSAPQGGNGGGAPLASLGAEGYKL
  397-  449 (87.61/58.97)	GDRLNAHCFEGLKNEYpHRRVSQDDNDIRTSSLPGTKRSGLPDDSLSRPTKKL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      65.64|      21|      33|     166|     186|       5
---------------------------------------------------------------------------
  166-  186 (35.78/30.02)	LHRDLKPANIMVT...SAGEVKIG
  198-  221 (29.86/23.77)	LHSLFSGDKVVVTiwyRAPELILG
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP00013 with CDK8 domain of Kingdom Fungi

Unable to open file!