PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_6171	SRP_SOYBN	--NA--	"Glycine max"	Fabaceae	Defensin	Signaling-peptide	"Signal | 8.4 kDa sulfur-rich protein precursor (Protein SE60) (Probable,proteinase inhibitor P322)."	--NA--	MEMRKSCGFFFLLLLLVFASQVVVQTEGRVCESQSHGFHGLCNRDHNCALVCRNEGFSGGRCKRSRRCFCTRIC	74	"Protein inferred from homology"	8436.87	8431.03	9.06	--NA--	"FUNCTION:May function as a sulfur-rich storage protein or a proteinase inhibitor.SIMILARITY:Belongs to the plant defensin family."