PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_6168	PSK1_ORYSI	--NA--	"Oryza sativa subsp. Indica"	Poaceae	--NA--	Signaling-peptide	"Developmental protein; Differentiation; Direct protein sequencing; Glycoprotein; Growth factor; Secreted; Signal; Sulfation | Phytosulfokines 1 precursor [Contains: Phytosulfokine-alpha (PSK-,alpha) (Phytosulfokine-a); Phytosulfokine-beta (PSK-beta),(Phytosulfokine-b)].Secreted."	--NA--	MVNPGRTARALCLLCLALLLLGQDTHSRKLLLQEKHSHGVGNGTTTTQEPSRENGGSTGSNNNGQLQFDSAKWEEFHTDYIYTQDVKNP	89	"Experimental evidence at protein level"	9811.87	9805.82	6.39	--NA--	"FUNCTION:Promotes plant cell differentiation, organogenesis and somatic embryogenesis as well as cell proliferation.TISSUE SPECIFICITY:Expressed throughout the seedling. More abundant in fragments containing shoot or root apexes where cells proliferate vigorously.PTM:Sulfation is important for activity and for the binding to a putative membrane receptor.PTM:PSK-alpha is produced by endopeptidase digestion. PSK-beta is produced from PSK-alpha by exopeptidase digestion.MISCELLANEOUS:The N-terminal tripeptide (YIY) is the active core.SIMILARITY:Belongs to the phytosulfokine family."
