PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_6157	NO10_MEDSA	--NA--	"Medicago sativa"	Fabaceae	--NA--	Signaling-peptide	"Nodulation; Repeat; Signal | Early nodulin 10 precursor."	--NA--	MTCTLKSPPKMASFFLSSLVLMFIAALILLPQGLAAYKLTPTYKPPDSELPFQKLPPFYKQAPPSQKLPRVNPPYRNFVPPFALNPVYNAPIYKTPNSPPIYNPPIYEAPPTYKPSKKRLPP	122	"Experimental evidence at transcript level"	13728.34	13719.39	9.92	--NA--	"TISSUE SPECIFICITY:Root nodules. In early nodules, expressed only in the interior of the developing nodule with no expression in other nodule tissues, including meristem. In slightly older nodules, expressed in almost all cells of the central zone. In more mature nodules, expression is restricted to the invasion zone.INDUCTION:Expressed from day 6 after rhizobium infection.Persists up to 43 days after infection."