PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_6156	AGP26_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Complete proteome; Glycoprotein; GPI-anchor; Lipoprotein; Membrane; Proteoglycan; Signal | Classical arabinogalactan protein 26 precursor.Cell membrane; Lipid-anchor, GPI-anchor (Potential)."	--NA--	MSVSLFTAFTVLSLCLHTSTSEFQLSTISAAPSFLPEAPSSFSASTPAMSPDTSPLFPTPGSSEMSPSPSESSIMPTIPSSLSPPNPDAVTPDPLLEVSPVGSPLPASSSVCLVSSQLSSLLLVLLMLLLAFCSFF	136	"Experimental evidence at transcript level"	13983.08	13973.93	3.62	--NA--	"FUNCTION:Proteoglycan that seems to be implicated in diverse developmental roles such as differentiation, cell-cell recognition, embryogenesis and programmed cell death.PTM:O-glycosylated on the hydroxyproline residues (By similarity).SIMILARITY:Belongs to the classical AGP family."