PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_6138	PR1_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Apoplast; Complete proteome; Direct protein sequencing; Pathogenesis-related protein; Plant defense; Pyrrolidone carboxylic acid; Secreted; Signal | Pathogenesis-related protein 1 precursor (PR-1).Secreted, extracellular space, apoplast."	--NA--	MNFTGYSRFLIVFVALVGALVLPSKAQDSPQDYLRVHNQARGAVGVGPMQPRGNYVNEKPYSEKANYNYAANTCNGVCGHYTQVVWRKSVRLGCAKVRCNNGGTIISCNYDWDERVAAYARSYAEQLRGNCRLIHSGGPYGENLAWGSGDLSGVSAVNMWV	161	"Experimental evidence at protein level"	17676.94	17665.61	9.08	--NA--	"FUNCTION:Partially responsible for acquired pathogen resistance.INDUCTION:By 2,6-dichloroisonicotinic acid (INA) and salicylic acid (possibly an endogenous signal for acquired resistance).Strongly induced by pathogen infection.SIMILARITY:Belongs to the CRISP family."