PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_6136	VAS_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Complete proteome; Lipid-binding; Signal; Transport | Lipid transfer-like protein VAS precursor."	--NA--	MMMGMKFFSFYVVLLLVAASSGMRINGQSVSCLNQLAPCLNYLNGTKEVPQVCCNPLKSVIRNNPECLCRMISNRWSSQAERAGIDVNDAQMLPARCGEHSVNPIACLTRSRGGSTNSDRSSSIGNTFSQSYWMTTLAIAATVLSYCHHII	151	"Experimental evidence at transcript level"	16532.12	16520.99	8.82	--NA--	"FUNCTION:Promotes the number of phloem (pro)cambial and pericycle cells.TISSUE SPECIFICITY:Expressed in vascular tissues of all organs.SIMILARITY:Belongs to the plant LTP family."