PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_6135	PSK1_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Complete proteome; Developmental protein; Differentiation; Growth factor; Secreted; Signal; Sulfation | Phytosulfokines 1 precursor (AtPSK1) [Contains: Phytosulfokine-alpha,(PSK-alpha) (Phytosulfokine-a); Phytosulfokine-beta (PSK-beta),(Phytosulfokine-b)].Secreted (By similarity)."	--NA--	MMKTKSEVLIFFFTLVLLLSMASSVILREDGFAPPKPSPTTHEKASTKGDRDGVECKNSDSEEECLVKKTVAAHTDYIYTQDLNLSP	87	"Experimental evidence at transcript level"	9653.04	9646.84	5.25	--NA--	"FUNCTION:Promotes plant cell differentiation, organogenesis and somatic embryogenesis as well as cell proliferation (By similarity).TISSUE SPECIFICITY:Expressed in stems, roots and leaves.PTM:Sulfation is important for activity and for the binding to a putative membrane receptor (By similarity).PTM:PSK-beta is produced from PSK-alpha by exopeptidase digestion (By similarity).SIMILARITY:Belongs to the phytosulfokine family."