PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_6123	CYC6_PORYE	--NA--	"Porphyra yezoensis"	Bangiaceae	--NA--	Signaling-peptide	"3D-structure; Chloroplast; Electron transport; Heme; Iron; Metal-binding; Photosynthesis; Plastid; Signal; Thylakoid; Transport | Cytochrome c6 precursor (Soluble cytochrome f) (Cytochrome c553),(Cytochrome c-553).Plastid, chloroplast thylakoid lumen (By similarity)."	--NA--	MKKKLSVLFTVFSFFVIGFAQIAFAADLDNGEKVFSANCAACHAGGNNAIMPDKTLKKDVLEANSMNTIDAITYQVQNGKNAMPAFGGRLVDEDIEDAANYVLSQSEKGW	110	"Experimental evidence at protein level"	11899.53	11891.86	4.96	--NA--	"FUNCTION:Functions as an electron carrier between membrane-bound cytochrome b6-f and photosystem I in oxygenic photosynthesis (By similarity).SUBUNIT:Monomer (By similarity).PTM:Binds 1 heme group per subunit.SIMILARITY:Belongs to the cytochrome c family. PetJ subfamily."