PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_6119	LCR30_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Complete proteome; Signal | Low-molecular-weight cysteine-rich protein LCR30 precursor."	--NA--	MHGTAAKGTCMPKPSKQCVCTYSCNAMSKTTVIAIFMVVLVLGLVTKETQGQELCHDYMSGTELCEEDKCVAKCIW	76	"Experimental evidence at transcript level"	8295.83	8289.89	6.68	--NA--	"TISSUE SPECIFICITY:Expressed in flower buds, but not in stems, roots or rosette leaves.SIMILARITY:Belongs to the LCR protein family."