PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_6116	NLTP_DAUCA	--NA--	"Daucus carota"	Apiaceae	--NA--	Signaling-peptide	"Lipid-binding; Signal; Transport | Non-specific lipid-transfer protein precursor (LTP) (Extracellular,protein 2)."	--NA--	MGVLRSSFVAMMVMYMVLATTPNAEAVLTCGQVTGALAPCLGYLRSQVNVPVPLTCCNVVRGLNNAARTTLDKRTACGCLKQTANAVTGLNLNAAAGLPARCGVNIPYKISPTTDCNRVV	120	"Experimental evidence at transcript level"	12503.77	12495.35	9.24	--NA--	"FUNCTION:Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.TISSUE SPECIFICITY:Expressed in protoderm cells of somatic and zygotic embryos, and transiently expressed in epidermal cell layers of leaves, flowers and seeds.SIMILARITY:Belongs to the plant LTP family."