PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_6114	GRP7_DAUCA	--NA--	"Daucus carota"	Apiaceae	--NA--	Signaling-peptide	"Repeat; Signal | Glycine-rich protein DC7.1 precursor."	--NA--	MGSKIFLLLGLSIAFALLISSEVAARDLSETTTEGASLDGGHHGGGGGGHYSGGGGHGGSHHGGGGHGGCHHYCHGSCCSAAEAKALEAAQVKPQN	96	"Experimental evidence at transcript level"	9319.21	9313.34	6.33	--NA--	"FUNCTION:May be connected with the initiation of embryogenesis or with the metabolic changes produced by the removal of auxins.DEVELOPMENTAL STAGE:Transiently expressed during early embryogenesis.INDUCTION:By the removal of auxins."