PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_6110	ITI5_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Complete proteome; Protease inhibitor; Secreted; Serine protease inhibitor; Signal | Putative trypsin inhibitor At2g43530 precursor.Secreted (Potential)."	--NA--	MGMAMKSVSNFAIFLILFLVTSEISEIEAKDKECLKGYIDAPLSYCMARIYPSLCYRNCRFYKGAKGGKCDGLKCFCDFCSDKPF	85	"Protein inferred from homology"	9596.38	9589.6	8.42	--NA--	"SIMILARITY:Belongs to the protease inhibitor I18 (RTI/MTI-2) family."