PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_6104	AGP12_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Complete proteome; Direct protein sequencing; Glycoprotein; GPI-anchor; Hydroxylation; Lipoprotein; Membrane; Proteoglycan; Pyrrolidone carboxylic acid; Signal | Arabinogalactan peptide 12 precursor (AG-peptide 12).Cell membrane; Lipid-anchor, GPI-anchor (Potential)."	--NA--	MESMKMKLIVVLMVAIVAFSAVGNVAAQTEAPAPSPTSDAAMFVPALFASVAALASGFLF	60	"Experimental evidence at protein level"	6089.29	6085.16	4.68	--NA--	"FUNCTION:Proteoglycan that seems to be implicated in diverse developmental roles such as differentiation, cell-cell recognition, embryogenesis and programmed cell death.PTM:O-glycosylated on hydroxyprolines; noncontiguous hydroxylproline residues are glycosylated with arabinogalactan.SIMILARITY:Belongs to the AG-peptide AGP family."