PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_6099	D230_PEA	--NA--	"Pisum sativum"	Fabaceae	--NA--	Signaling-peptide	"Pathogenesis-related protein; Plant defense; Signal | Disease resistance response protein 230 precursor."	--NA--	MEKKSLACLSFLLLVLFVAQEIVVSEANTCENLAGSYKGVCFGGCDRHCRTQEGAISGRCRDDFRCWCTKNC	72	"Experimental evidence at transcript level"	7986.25	7980.75	7.49	--NA--	"INDUCTION:Upon contact with the plant pathogen fungus Fusarium solani.PTM:Contains four disulfide bonds (Probable).SIMILARITY:Belongs to the plant defensin family."