PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_6098	NLTP5_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Complete proteome; Direct protein sequencing; Lipid-binding; Signal; Transport | Non-specific lipid-transfer protein 5 precursor (LTP 5)."	--NA--	MEGLLKLSTLVIVCMLVTAPMASEAAISCGAVTGSLGQCYNYLTRGGFIPRGCCSGVQRLNSLARTTRDRQQACRCIQGAARALGSRLNAGRAARLPGACRVRISYPISARTNCNTVR	118	"Experimental evidence at protein level"	12494.64	12486.39	10.43	--NA--	"FUNCTION:Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues (By similarity).SIMILARITY:Belongs to the plant LTP family."
