PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_6097	A9_BRANA	--NA--	"Brassica napus"	Brassicaceae	--NA--	Signaling-peptide	"Secreted; Signal | Tapetum-specific protein A9 precursor.Secreted (Potential)."	--NA--	MEFLKSFTTILFVMFLAMSALETVPMVRAQQCLDNLSNMQVCAPLVLPGAVNPAPNSNCCIALQATNKDCICNALRAATTFTTTCNLPSLDCGITI	96	"Experimental evidence at transcript level"	10276.16	10269.01	4.86	--NA--	"TISSUE SPECIFICITY:Tapetum of anthers.DEVELOPMENTAL STAGE:Found when sporogenous cells are in early meiosis. Disappears totally as the microspores go into interphase, when the tapetal cell layer degenerates.SIMILARITY:Belongs to the A9/FIL1 family."