PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_6096	AGP14_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Complete proteome; Direct protein sequencing; Glycoprotein; GPI-anchor; Hydroxylation; Lipoprotein; Membrane; Proteoglycan; Signal | Arabinogalactan peptide 14 precursor (AG-peptide 14).Cell membrane; Lipid-anchor, GPI-anchor (Potential)."	--NA--	MEAMKMKLYVVVLVAVIAFSTVHQTVAAVDAPAPSPTSDASSFIPTFFASVAVMAFGFFF	60	"Experimental evidence at protein level"	6362.53	6358.23	5.36	--NA--	"FUNCTION:Proteoglycan that seems to be implicated in diverse developmental roles such as differentiation, cell-cell recognition, embryogenesis and programmed cell death.PTM:O-glycosylated on hydroxyprolines; noncontiguous hydroxylproline residues are glycosylated with arabinogalactan.SIMILARITY:Belongs to the AG-peptide AGP family."