PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_6094	IP2K_SOLTU	--NA--	"Solanum tuberosum"	Solanaceae	--NA--	Signaling-peptide	"3D-structure; Protease inhibitor; Repeat; Serine protease inhibitor; Signal | Proteinase inhibitor type-2 K precursor (Proteinase inhibitor type II,K) (IIK) [Contains: Proteinase inhibitor PCI-1 (Proteinase inhibitor,PCI-I)]."	--NA--	MDVHKEVNFVAYLLIVLGLLVLVSAMDVDAKACIRECGNLGFGICPRSEGPAMSKCPRSEGKSLIYPTGCTTCCTGYKGCYYFGKNGKFVCEGESDEPKANMYSPENPICTNCCAGYKGCNYYSANGAFICEGQSDPKKPKACPLNCDPHIAY	153	"Experimental evidence at protein level"	16505.04	16493.6	6.67	--NA--	"FUNCTION:Inhibitor of trypsin and chymotrypsin.INDUCTION:By wounding.SIMILARITY:Belongs to the protease inhibitor I20 (potato type II proteinase inhibitor) family."