PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_6078	ZEA7_MAIZE	--NA--	"Zea mays"	Poaceae	--NA--	Signaling-peptide	"Repeat; Seed storage protein; Signal; Storage protein | Zein-alpha A20 precursor (19 kDa zein A20)."	--NA--	MATKIFSLLMLLALSACVANATIFPQCSQAPIASLLPPYLPSMIASVCENPALQPYRLQQAIAASNIPLSPLLFQQSPALSLVQSLVQTIRAQQLQQLVLPVINQVALANLSPYSQQQQFLPFNQLSTLNPAAYLQQQLLPFSQLATAYSQFAANPATLLQLQQLLPFVQLALTDPAASYQQHIIGGALFQQQQLLPFNQLAALNPAAYLQQQILLPFSQLAAANRASFLTQQQLLPFYQ	240	"Experimental evidence at transcript level"	26240.62	26223.99	8.52	--NA--	"FUNCTION:Zeins are major seed storage proteins.MISCELLANEOUS:The alpha zeins of 19 kDa and 22 kDa account for 70% of the total zein fraction. They are encoded by a large multigene family.MISCELLANEOUS:Structurally, 22K and 19K zeins are composed of nine adjacent, topologically antiparallel helices clustered within a distorted cylinder.SIMILARITY:Belongs to the zein family."
