PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_6076	ALB1B_PEA	--NA--	"Pisum sativum"	Fabaceae	--NA--	Signaling-peptide	"Knottin; Plant toxin; Seed storage protein; Signal; Storage protein; Toxin | Albumin-1 B precursor (PA1 B) [Contains: Albumin-1 B chain b (PA1b B),(Leginsulin B); Albumin-1 B chain a (PA1a B)]."	--NA--	MASVKLASLMVLFATLGMFLTKNVGAASCNGVCSPFEMPPCGSSACRCIPVGLVVGYCRHPSGVFLRTNDEHPNLCESDADCRKKGSGNFCGHYPNPDIEYGWCFASKSEAEDFFSKITQKDLLKSVSTA	130	"Experimental evidence at transcript level"	13970.05	13960.58	6.78	--NA--	"FUNCTION:PA1b binds to basic 7S globulin (BG) and stimulates its phosphorylation activity. Involved in the signal transduction system to regulate the growth and differentiation as a hormone peptide. Toxic to various insects through binding to a high affinity binding site in the insect gut (By similarity).TISSUE SPECIFICITY:Major component of both the cotyledons and embryonic axes of mature seeds.DEVELOPMENTAL STAGE:Increasing expression during seed development followed by a rapid degradation during the first days of seed germination.DOMAIN:The presence of a 'disulfide through disulfide knot' structurally defines this protein as a knottin (By similarity).PTM:The C-terminal glycine may be removed from PA1b."
