PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_6071	ITR5_LUFCY	--NA--	"Luffa cylindrica"	Cucurbitaceae	--NA--	Signaling-peptide	"Direct protein sequencing; Knottin; Protease inhibitor; Secreted; Serine protease inhibitor; Signal | Trypsin inhibitor 5 precursor (Trypsin inhibitor II) (TGT-II).Secreted."	--NA--	MASVAESSGVVEVIELISDGGNDLPRKIMSGRHGGICPRILMPCKTDDDCMLDCRCLSNGYCG	63	"Experimental evidence at protein level"	6690.74	6686.08	4.75	--NA--	"FUNCTION:Inhibits trypsin.DOMAIN:The presence of a 'disulfide through disulfide knot' structurally defines this protein as a knottin (By similarity).SIMILARITY:Belongs to the protease inhibitor I7 (squash-type serine protease inhibitor) family."