PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_6068	AGP16_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Alternative splicing; Complete proteome; Direct protein sequencing; Glycoprotein; GPI-anchor; Hydroxylation; Lipoprotein; Membrane; Proteoglycan; Pyrrolidone carboxylic acid; Signal | Arabinogalactan peptide 16 precursor (AG-peptide 16).Cell membrane; Lipid-anchor, GPI-anchor (Potential)."	--NA--	MASRNSVTGFALFSFVFAVILSLAGAQSLAPAPAPTSDGTSIDQGIAYLLMVVALVLTYLIHPLDASSSYSFF	73	"Experimental evidence at protein level"	7601.8	7596.93	4.41	--NA--	"FUNCTION:Proteoglycan that seems to be implicated in diverse developmental roles such as differentiation, cell-cell recognition, embryogenesis and programmed cell death.ALTERNATIVE PRODUCTS:Event=Alternative splicing; Named isoforms=1; Comment=A number of isoforms are produced. According to EST sequences; Name=1; IsoId=O82337-1; Sequence=Displayed;TISSUE SPECIFICITY:Predominantly expressed in flowers.PTM:O-glycosylated on hydroxyprolines; noncontiguous hydroxylproline residues are glycosylated with arabinogalactan.SIMILARITY:Belongs to the AG-peptide AGP family."