PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_6067	AGP20_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Complete proteome; Glycoprotein; GPI-anchor; Lipoprotein; Membrane; Proteoglycan; Pyrrolidone carboxylic acid; Signal | Arabinogalactan peptide 20 precursor (AG-peptide 20).Cell membrane; Lipid-anchor, GPI-anchor (Potential)."	--NA--	MASRNSVAVIALFAFVFAVISPFAGAQSLAPAPSPTSDGTSIDQGIAYLLMVVALVLTYLIHPLDASSSSYTFF	74	"Experimental evidence at protein level"	7698.91	7693.98	4.41	--NA--	"FUNCTION:Proteoglycan that seems to be implicated in diverse developmental roles such as differentiation, cell-cell recognition, embryogenesis and programmed cell death.PTM:O-glycosylated on the hydroxyproline residues (By similarity).SIMILARITY:Belongs to the AG-peptide AGP family."