PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_6063	NO12B_PEA	--NA--	"Pisum sativum"	Fabaceae	--NA--	Signaling-peptide	"Cell wall; Nodulation; Repeat; Secreted; Signal | Early nodulin 12B precursor (N-12B).Secreted, cell wall (Potential)."	--NA--	MASLFLSSLVLFLAALILVPQGFAQYHLNPVDEPPVNEPTVNKPPQKETPVYKPPQKKSPWYMPEQKESHLHVYDKHLTAEHNIHI	86	"Experimental evidence at transcript level"	9864.4	9858.14	6.57	--NA--	"FUNCTION:Involved in the infection process during the plant- rhizobium interaction.TISSUE SPECIFICITY:Root nodules, stem and flower.SIMILARITY:Belongs to the ENOD12 family."