PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_6062	AGP10_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Complete proteome; Direct protein sequencing; Glycoprotein; GPI-anchor; Hydroxylation; Lipoprotein; Membrane; Proteoglycan; Pyrrolidone carboxylic acid; Signal | Classical arabinogalactan protein 10 precursor.Cell membrane; Lipid-anchor, GPI-anchor (Potential)."	--NA--	MASKSVVVLLFLALIASSAIAQAPGPAPTRSPLPSPAQPPRTAAPTPSITPTPTPTPSATPTAAPVSPPAGSPLPSSASPPAPPTSLTPDGAPVAGPTGSTPVDNNNAATLAAGSLAGFVFVASLLL	127	"Experimental evidence at protein level"	12070.81	12063.39	8.5	--NA--	"FUNCTION:Proteoglycan that seems to be implicated in diverse developmental roles such as differentiation, cell-cell recognition, embryogenesis and programmed cell death.TISSUE SPECIFICITY:Predominantly expressed in flowers and at a lower level in roots and siliques.PTM:O-glycosylated on hydroxyprolines; noncontiguous hydroxylproline residues are glycosylated with arabinogalactan.SIMILARITY:Belongs to the classical AGP family."
