PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_6058	NO12B_MEDSA	--NA--	"Medicago sativa"	Fabaceae	--NA--	Signaling-peptide	"Cell wall; Nodulation; Repeat; Secreted; Signal | Early nodulin 12B precursor (N-12B).Secreted, cell wall (By similarity)."	--NA--	MASFSLSILVFFISALVLVPQGFAEYYLNPAYRPPQTKPPVNKPSHKEPPTHKHPPAEDNIHFVHKPPHKEPPVNKPRHKEPPVHKPPHKDPPVNKPPQKESPVHKPPRKEPP	113	"Experimental evidence at transcript level"	12848.9	12840.86	9.84	--NA--	"FUNCTION:Involved in the infection process during the plant- rhizobium interaction (By similarity).TISSUE SPECIFICITY:Expressed only in young nodules.SIMILARITY:Belongs to the ENOD12 family."