PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_6056	NO12A_MEDSA	--NA--	"Medicago sativa"	Fabaceae	--NA--	Signaling-peptide	"Cell wall; Cell wall biogenesis/degradation; Nodulation; Repeat; Secreted; Signal | Early nodulin 12A precursor (N-12A) (Early nodulin NMS-8).Secreted, cell wall (By similarity)."	--NA--	MASFLLSILVFFLSALVLVPQGFAEYYLNPAYRPPQTEPPVHKPPHKEPPVHKPPHKDPPVNKPPQKEPPVHKPPRKEPPTHRHPPSEDNIHF	93	"Experimental evidence at transcript level"	10632.33	10625.63	9.35	--NA--	"FUNCTION:Involved in the infection process during the plant- rhizobium interaction (By similarity).TISSUE SPECIFICITY:More abundant in the young nodules than the mature nodules.SIMILARITY:Belongs to the ENOD12 family."