PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_6053	NLTP8_HORVU	--NA--	"Hordeum vulgare"	Poaceae	--NA--	Signaling-peptide	"Direct protein sequencing; Lipid-binding; Signal; Transport | Non-specific lipid-transfer protein Cw18 precursor (LTP Cw-18),(PKG2316)."	--NA--	MARTAATKLALVALVAAMLLVAADAAITCGQVSSALGPCAAYAKGSGTSPSAGCCSGVKRLAGLARSTADKQATCRCLKSVAGAYNAGRAAGIPSRCGVSVPYTISASVDCSKIH	115	"Experimental evidence at protein level"	11221.08	11213.7	9.46	--NA--	"FUNCTION:Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.TISSUE SPECIFICITY:Highly expressed in leaves and coleoptiles. No expression in roots.INDUCTION:By NaCl, abscisic acid and inoculation with the fungal pathogen E.graminis.SIMILARITY:Belongs to the plant LTP family."