PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_6033	AMP1_MESCR	--NA--	"Mesembryanthemum crystallinum"	Aizoaceae	--NA--	Signaling-peptide	"Antibiotic; Antimicrobial; Fungicide; Knottin; Plant defense; Secreted; Signal | Antimicrobial peptide 1 precursor.Secreted."	--NA--	MAKVSSSLLKFAIVLILVLSMSAIISAKCIKNGKGCREDQGPPFCCSGFCYRQVGWARGYCKNR	64	"Protein inferred from homology"	7005.41	7000.56	9.59	--NA--	"FUNCTION:Possesses antifungal and antibacterial activity (By similarity).DOMAIN:The presence of a 'disulfide through disulfide knot' structurally defines this protein as a knottin (By similarity).SIMILARITY:Belongs to the AMP family."
